Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

Search Within Results

1,756 – 1,770 of 119,733 results

1,756

Novus Biologicals™ ADAT2 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	ADAT2
Molecular Weight (g/mol)	23.2kDa
Gene ID (Entrez)	134637
Immunogen	ADAT2, 1-191aa. MGSSHHHHHHSSGLVPRGSHMEAKAAPKPAASGACSVSAEETEKWMEEAMHMAKEALENTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGKSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRPFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	0.5mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

1,757

Novus Biologicals™ Recombinant Human PPIL1 His Protein

Highly purified and high bioactivity. Generating reliable and reproducible results. Applications: Functional, SDS-Page, Bioactivity

Pricing & Availability

1,758

Novus Biologicals™ Recombinant Human RCAN3 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

1,759

Novus Biologicals™ ARF6 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	ARF6
Molecular Weight (g/mol)	22.2kDa
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1.0mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Recombinant human ARF6 protein, fused to His-tag at N-terminus, expressed in E. coli
Accession Number	NP_001654
Regulatory Status	RUO
Purification Method	Protein
Gene ID (Entrez)	382
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 0.2mM PMSF
Immunogen	ARF6, 1-175aa, Human, His tag, E. coli (NP_001654).
Recombinant	Recombinant

1,760

R&D Systems™ Recombinant Human EpCAM/TROP1 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

1,761

Invitrogen™ Human E-selectin (CD62E) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Formulation	0.02 M tris HCl with 100 mM NaCl, 1 mM EDTA, 50% glycerol and no preservative; pH 8
Sequence	Amino acids Asn179- Leu557 containing an N-terminal His-tag
Concentration	0.105 mg/mL
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human E-selectin (CD62E)
Recombinant	Recombinant

1,762

Invitrogen™ Human PON2 Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Formulation	20 mM tris HCl with 50% glycerol and no preservative; pH 8
Sequence	Amino acids Met1- Leu354 containing an N-terminal His-tag
Concentration	0.10 mg/mL
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human PON2
Recombinant	Recombinant

1,763

Novus Biologicals™ Recombinant Human AMPK beta 2/PRKAB2 His Protein

Highly purified. Generating reliable and reproducible results. Applications: SDS-Page

Pricing & Availability

1,764

R&D Systems™ Recombinant Human Angiopoietin-1, Biotinylated Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,765

Promotions Available

R&D Systems™ Recombinant Mouse DC-SIGN/CD209 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

1,766

Novus Biologicals™ MRP2 Recombinant Protein Antigen

Recombinant Protein

Pricing & Availability

1,767

Novus Biologicals™ Recombinant Human PLA2G16/HRASLS3 Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability

1,768

Novus Biologicals™ eIF4H Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	SDS-PAGE
Purity or Quality Grade	>90%
Conjugate	Unconjugated
Common Name	eIF4H
Storage Requirements	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
For Use With (Application)	SDS-PAGE
Source	Human

1,769

R&D Systems™ Recombinant Human Angiopoietin-like 7 Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability
Specifications

Purity or Quality Grade	95%, by SDS-PAGE under reducing conditions and visualized by silver stain.
Conjugate	Unconjugated
Molecular Weight (g/mol)	38.6 kDa
Gene ID (Entrez)	10218
Quantity	25 μg
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.
Source	Chinese Hamster Ovary cell line,CHO-derived human Angiopoietin-like Protein 7/ANGPTL7 protein Met1-Pro346,with a C-terminal 10-His tag
Recombinant	Recombinant
Name	Angiopoietin-like Protein 7/ANGPTL7

1,770

R&D Systems™ Recombinant SARS-CoV-2 +E484K B.1.1.7 Spike GCN4-IZ Protein

Alpha Variant (UK) with E484K Point Mutation. His-tag.

Pricing & Availability

Prev
1
...
116
117
118
119
...
7,983
Next

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ ADAT2 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PPIL1 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human RCAN3 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ARF6 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human AMPK beta 2/PRKAB2 His Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ MRP2 Recombinant Protein Antigen Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human PLA2G16/HRASLS3 Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ eIF4H Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ ADAT2 Protein

Novus Biologicals™ Recombinant Human PPIL1 His Protein

Novus Biologicals™ Recombinant Human RCAN3 His Protein

Novus Biologicals™ ARF6 Protein

Novus Biologicals™ Recombinant Human AMPK beta 2/PRKAB2 His Protein

Novus Biologicals™ MRP2 Recombinant Protein Antigen

Novus Biologicals™ Recombinant Human PLA2G16/HRASLS3 Protein

Novus Biologicals™ eIF4H Protein